PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN06834.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 551aa    MW: 62218.9 Da    PI: 6.3126
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN06834.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.85.9e-142266348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      WT+eEd++l + +  +G+++W+ Ia+++   +t  qc+ rw++yl
       KHN06834.1 22 TWTQEEDDILREQIGIHGTENWAIIASKFK-DKTTRQCRRRWYTYL 66
                     6****************************9.*************97 PP

2Myb_DNA-binding41.43.3e-1372115146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g W++eEd ll +a k +G++ W+ Ia+ +  gRt++ +k+r+ +
       KHN06834.1  72 KGGWSAEEDMLLCEAQKVFGNR-WTEIAKVVS-GRTDNAVKNRFST 115
                      688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.4451570IPR017930Myb domain
SMARTSM007172.7E-131968IPR001005SANT/Myb domain
SuperFamilySSF466892.51E-2519113IPR009057Homeodomain-like
CDDcd001671.68E-122266No hitNo description
Gene3DG3DSA:1.10.10.604.0E-202373IPR009057Homeodomain-like
PfamPF139211.3E-142383No hitNo description
SMARTSM007177.3E-1471119IPR001005SANT/Myb domain
PROSITE profilePS5129417.02371121IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-1974120IPR009057Homeodomain-like
CDDcd001678.12E-1075116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 551 aa     Download sequence    Send to blast
MVQDMKQQDN GESKKKERHI VTWTQEEDDI LREQIGIHGT ENWAIIASKF KDKTTRQCRR  60
RWYTYLNSDF KKGGWSAEED MLLCEAQKVF GNRWTEIAKV VSGRTDNAVK NRFSTLCRKK  120
QKYAALAKEN STSYINSNNK RMMLQHCNNM DTTSESGVPI KNLRRADIAD DAEKIKFEDR  180
SHLRNGTPIN QQPRAPLAVL AQNSHNSNNL TDQHHLCNPK FSSSAQNNKI QGTFLKKDDP  240
KISALMQQAE LLSSLALKVD TENMDQSLEN AWKVLQEFLN RSKESDIPGQ KVPDVRLVDL  300
KDMIEELKSG NEEGRVLQEL LNRTKESDST GHKIPDLRPA DFKDMVEDSK SGNEEGQVLQ  360
EFLNRTNKSD IPEHKIPNLQ LVDLKDMIED LKSGNEEGQA CWRKMDCYEN SPGSSGYSTG  420
SILICQSASD NLEHSLHQDI GTEMKSKQLE DEKGVKVVMP TANVDQDMVP CCMEQINNDG  480
IVSTSSRLEF SSPLQVTPLF RSLAAGIPSP QFSESERNFL RKTLGMESPS INPSANSSQP  540
PPCKRALLPS L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-262312010107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0086665e-80KF008666.1 Scutellaria baicalensis MYB18 (myb) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006586015.10.0PREDICTED: uncharacterized protein LOC100803361
RefseqXP_014634834.10.0PREDICTED: uncharacterized protein LOC100803361
TrEMBLA0A0B2PGQ10.0A0A0B2PGQ1_GLYSO; Myb-related protein B
STRINGGLYMA08G40950.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34803461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14350.21e-146MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]